Babun – Aluminum and Glass Installation and Repair Services Elementor Template Kit
Original price was: $22.00.$3.00Current price is: $3.00.
Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit download
Download Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit free with Srmehranclub membership, You will get the exact files and version that listed on the official site, But We do not provide support & License key for more information kindly check our terms & Conditions. All Products are Pre Activate for your domain, Because of All products come under the GPL License.
Why Srmehranclub Membership ?
- Access to All 37,396+ Premium Themes, Plugins, Scripts & Templates
- We're the Only oldest(Since 2016) & Most Trustworthy best GPL Company
- Automatic, Toolkit update & Srmehran Templates & kit plugins included.
- 24/7 Technical Support via Ticket, Live Chat & Phone Support
- 100% Original Authentic & Verified Products
Description
Babun – Aluminum and Glass Installation and Repair Services Elementor Template Kit
Download Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit at cheap price:-
Babun is suitable for those of you who have aluminum and glass installation and repair services for personal or campany, so that your services are known and professional. Built with a contemporary and modern design and also easy to customize
Templates
- Home
- About
- Services
- Our work
- Pricing
- 404
- Contact us
- Faq
- Header
- Footer
Required Plugins installed with kit
- Elementor
Elementor Pro upgrade is required for some templates and features (not included)
How to Use Template Kits:
- Install and Activate the “Envato Elements” plugin from Plugins > Add New in WordPress
- Download your kit file and Do not unzip
- Go to Elements > Installed Kits and click the Upload Template Kit button. You may also import automatically by clicking Connect Account to link your Elements subscription, then import under Elements > Template Kits.
- Check for the orange banner at the top and click Install Requirements to load any plugins the kit uses
- Click import on the Global Kit Styles first
- Click Import on one template at a time. These are stored in Elementor under Templates > Saved Templates.
- Go to Pages and create a new page and click Edit with Elementor
- Click the gear icon at lower-left of the builder to view page settings and choose Elementor Full Width and hide page title
- Click the gray folder icon to access My Templates tab and then Import the page you’d like to customize.
If you have Elementor Pro, headers and footers may be customized under Theme Builder.
Detailed Guide: https://help.market.envato.com/hc/en-us/articles/900000842846-How-to-use-the-Envato-Elements-WordPress-Plugin-v2-0
For further support, go to Elementor > Get Help in WordPress menu.
This Template Kit uses demo images from Envato Elements. You will need to license these images from Envato Elements to use them on your website, or you can substitute them with your own.
- https://elements.envato.com/indoor-farming-aerial-top-view-of-glass-greenhouse-YY8RJY2
- https://elements.envato.com/chrome-door-handle-and-glass-of-modern-aluminium-d-KQ46ZS4
- https://elements.envato.com/window-in-skyscraper-PSR6RV9
- https://elements.envato.com/sink-and-window-JV29NET
- https://elements.envato.com/windows-on-the-wall-PMB6RV8
- https://elements.envato.com/window-YRVLAG2
- https://elements.envato.com/glass-facade-modern-architecture-building-business-5XANLMY
- https://elements.envato.com/abstract-architecture-windows-AZ2PKMQ
- https://elements.envato.com/minimalistic-leather-armchair-PN735Y4
- https://elements.envato.com/home-icons-FUT7CB3
- https://elements.envato.com/stained-glass-window-P33JQCA
- https://elements.envato.com/54476-glass-doors-on-wooden-patio-WL97C2R
- https://elements.envato.com/close-up-of-a-glass-door-MJZR8T9
- https://elements.envato.com/doors-logo-template-C93HXVA
- https://elements.envato.com/line-icons-S66ZM6
- https://elements.envato.com/the-logos-60-SYXSJF
Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit is developed by (Known and Good Developer)
If you want more information about this product then visit the main author’s website.
This plugin was uploaded on our website March 16, 2023
Download Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit HTML Template right now and set up your own High-End website in a matter of minutes.
You can get Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit here on a huge discount on individual purchase, If you buy Srmehranclub membership then You can free download Babun - Aluminum and Glass Installation and Repair Services Elementor Template Kit as well as You will get access to all the products (37396) free like WordPress, Woocommerce, Joomla, Drupal, Magento, Muse, Opencart, Prestashop, Shopify, Unbounce, Ghost, Tumblr, Virtuemart, Graphics, Html templates, Php script and more … free! We provide an automatic upgrade service for the wp plugin, Srmehranclub provides 24/7 hour support by Email, Live chat, Whatsapp, Skype, as well as Phone Call support.
Product | Type | Version | Last Update | Download |
---|---|---|---|---|
Babun – Aluminum and Glass Installation and Repair Services Elementor Template Kit | elementor templates kit | Latest | 2023-03-16 | Login to download |
Babun – Aluminum and Glass Installation and Repair Services Elementor Template Kit
Original price was: $22.00.$3.00Current price is: $3.00.
- Download verified by SiteLock.
- Technical support
- Unlimited domains use
- 100% Free From Virus / Malicious Script / Backdoor
- Lifetime update included
- Affordable price
- Direct download links
- 100% Legal & Safe
Product Details
Version Latest
Type Name Elementor Templates Kit
Release DateMarch 16, 2023
Last UpdateJanuary 8, 2024
Categories
HomeBusinessBusiness & ServiceBusiness Template KitElementorElementor TemplateHome & familyResponsiveResponsive .TemplateServicesServices Template KitsrppzthemeforestWordpressWordPress Premium Themes Free Download
Tags
aquariumBuildingcoverdecorationdoorEnvatoframeHouseinsulationInteriormetalpriyakpvcrailingsteeltheme8ThemeforesttransparentWindows