TechCard – Tailwind CSS 3 Card HTML Template
Original price was: $5.00.$3.00Current price is: $3.00.
TechCard - Tailwind CSS Card HTML Template download
Download TechCard - Tailwind CSS free with Srmehranclub membership, You will get the exact files and version that listed on the official site, But We do not provide support & License key for more information kindly check our terms & Conditions. All Products are Pre Activate for your domain, Because of All products come under the GPL License.
Why Srmehranclub Membership ?
- Access to All 38,496+ Premium Themes, Plugins, Scripts & Templates
- We're the Only oldest(Since 2016) & Most Trustworthy best GPL Company
- Automatic, Toolkit update & Srmehran Templates & kit plugins included.
- 24/7 Technical Support via Ticket, Live Chat & Phone Support
- 100% Original Authentic & Verified Products
TechCard – Tailwind CSS 3 Card HTML Template
Download TechCard - Tailwind CSS at cheap price:-
Description
TechCard – Tailwind CSS 3 Card HTML Template, the ultimate Hover Style Card! Crafted with Pure HTML and CSS, this sleek and responsive design offers 9 stunning Card Hover styles. Effortlessly showcase your team or project with ease and sophistication. Experience easy customization and compatibility with Tailwind components, making TechButton the perfect choice for your web project. Don’t miss out on this remarkable team showcase – elevate your website today! The TechCard library features a variety of Hover Card, Blog, social Blog, digital Blog, Portfolio, and Group Card Components. It offers raw compiled CSS files for easy customization. Customization is a breeze with its developer-friendly code and component-based design, perfect for various agencies and businesses. Integrating the animation is seamless; just copy the code from the source file, including HTML and Tailwind CSS.
Main Features:
- Build On the latest Tailwind CSS v3.3.3
- 9 Ultimate Hover Style Card
- Developer Friendly Code
- Fast Loading Speed
- Cross-Browser Compatibility
- Well-organized, commented & clean code
- Fully Responsive
- Google Fonts Support
- Easy Setup
Features
- You not need to install anything, Just click and run
- You can use it with admin
- Use it with tailwind css 3
- It’s contains pure css, javascript, html
- You can use it with following services: agency, real estate, education, portfolio, blog, travel, event, fashion, hotel, photography
- Some use cases: digital marketing, news, medical, email, nft, spa, industry, form, creative, sports, graphics, app, crypto, mobile, game, cv, resume, newsletter, web, gym, seo, airbnb, ngo, tech
- It can work with any css library: bulma, bootstrap 5, bootstrap 4, tailwindui,
- It can use with following language: asp, php, python, java, node, react, vue, wordpress, angular, remix, svelte, cakephp, express, redwoodjs
- You can use it with following framework easily: next, laravel, nuxt, svelte kit, qwik, ruby on rails, meteor, astro, shopify, .net, vue.js, django, spring, flask, codeigniter, symfony, native, reactnative, ionic, framework 7,
- You can also using following bundler: vite, parcel, yarn, npm, gulp
TechCard - Tailwind CSS is developed by Themeforest (Known and Good Developer)
If you want moreName is developed by Templatemonster . Here you can buy this product for only $ and it’s 100% Original. Srmehranclub Never Sells nulled or crack versions but We do not Provide License keys and premium support for more information check our Terms & Conditions.
information about this product then visit the main author’s website.
This plugin was uploaded on our website October 26, 2024
Download TechCard - Tailwind CSS HTML Template right now and set up your own High-End website in a matter of minutes.+
You can get TechCard - Tailwind CSS here on a huge discount on individual purchase, If you buy Srmehranclub membership then You can free download TechCard - Tailwind CSS as well as You will get access to all the products (38496) free like WordPress, Woocommerce, Joomla, Drupal, Magento, Muse, Opencart, Prestashop, Shopify, Unbounce, Ghost, Tumblr, Virtuemart, Graphics, Html templates, Php script and more … free! We provide an automatic upgrade service for the wp plugin, Srmehranclub provides 24/7 hour support by Email, Live chat, Whatsapp, Skype, as well as Phone Call support.
Product | Type | Version | Last Update | Download |
---|---|---|---|---|
TechCard – Tailwind CSS 3 Card HTML Template | template | Latest | 2024-10-26 | Login to download |
TechCard – Tailwind CSS 3 Card HTML Template
Original price was: $5.00.$3.00Current price is: $3.00.
All GPL products Access, Pricing starts from just $19
- Download verified by SiteLock.
- Technical support
- Unlimited domains use
- 100% Free From Virus / Malicious Script / Backdoor
- Lifetime update included
- Affordable price
- Direct download links
- 100% Legal & Safe
Product Details
Version Latest
Developer Name Themeforest
Type Name template
Release DateOctober 26, 2024
License TypeGPL
Last UpdateOctober 26, 2024
Categories
AgencyBlogBlog & News MagazineBusinessBusiness & ServicecardsconsultantconsultingCorporateCreativecsscss3designDesign and PhotographyDesingexceptwphover cardMulti-PurposeResponsivesrppztailwindTailwind CSStailwind team layouttailwindcss
Tags
blog cardCardcardsCreativecssDesignenvato elementshover cardHTMLportfolio cardpriyakscssstyletailwindtailwindcsstheme8Themeforest